WWW.kishhealthfamilyandspecialtycare .com - website information, analysis and reviews

General Info Hosting Info Alexa Ranking Quantcast Ranking Compete Ranking Mywot Ranking Widgets Reviews

 
 

General website information

 
KishHealth Family & Specialty Care
Kishwaukee Community Hospital is a community hospital in Northern Illinois. It has many of the technological advances found in regional medical centers. Located 60 miles west of Chicago, it serves the Northern Illinois University community and is the res
Keywords : KishHealth System, Kishwaukee Health System, Kishwaukee Health System Affiliates, Valley West Community Hospital, Hauser Ross Eye Institute & Surgicenter, DeKalb County Hospice, Illinois Regional Cancer Center, Kishwaukee Cancer Care Center, DeKalb MR
Last Update :26/December/2011
Google PR :3
Archive :Check how did the site look in the past?

 

Server and Hosting Information

 
Site IP address :66.225.32.50
Server type :Microsoft-IIS/6.0
Powered by :ASP.NET
DNS 1 :ns.tbc.net
DNS 2 :ns2.tbc.net
MX Domain 1 :proxy.kishhospital.com

 

Alexa Ranking Information - Alexa.com

 
Alexa rank : no data
Description :


Compare this site to:










 

Quantcast Ranking Information - Quantcast.com

 
Quantcast rank : 0 Average US daily traffic : 0

Compete Ranking Information - Compete.com

 
Compete rank : 0
Average daily unique visitors : 0

MyWot Ranking Information - MyWot.com

 
MyWot rank : 0
Trustworthiness : 0
Vendor reliability : 0
Privacy : 0
Child safety : 0

 

Widgets

 

Stats summary widget


website widget
Background:
Text:

Ratings widget


website widget
Background:
Text:

Website Reviews

 

Submit Review

 

Use this form to review kishhealthfamilyandspecialtycare .com and evaluate website's design, usability, functionality and its service.

Your Name:
Your E-mail:
Design:
Usability:
Functionality:
Service:
Your Comments:

No HTML allowed