| Leather Gloves Manufacturers - Leather Gloves Wholesale, Gloves Manufacturers India |
| Last Update : | 27/December/2011 |
| Google PR : | 2 |
| Internal links : | 9 |
| External links : | 4 |
| Archive : | Check how did the site look in the past? |
WWW.alnadeem-leather .com - website information, analysis and reviews
General Info Keywords density Hosting Info Alexa Ranking Quantcast Ranking Compete Ranking Mywot Ranking Related Sites Widgets Reviews
General website information 
Keywords density
| Keyword | Occurrences | Percentage |
|---|---|---|
| leather gloves | 19 | 16.96% |
| of leather | 6 | 5.36% |
| finished leather | 5 | 4.46% |
| gloves leather | 4 | 3.57% |
| we are | 4 | 3.57% |
| Keyword | Occurrences | Percentage |
|---|---|---|
| of leather gloves | 4 | 5.36% |
| gloves finished leather | 4 | 5.36% |
| leather driving gloves | 3 | 4.02% |
| gloves leather driving | 3 | 4.02% |
| leather for gloves | 3 | 4.02% |
Server and Hosting Information
| Site IP address : | 209.160.75.79 |
| Server type : | Apache |
| DNS 1 : | ns1.intermesh.net |
| DNS 2 : | ns2.intermesh.net |
| MX Domain 1 : | alt1.aspmx.l.google.com |
| MX Domain 2 : | alt2.aspmx.l.google.com |
| MX Domain 3 : | aspmx.l.google.com |
| MX Domain 4 : | aspmx2.googlemail.com |
| MX Domain 5 : | aspmx3.googlemail.com |
| MX Domain 6 : | aspmx4.googlemail.com |
| MX Domain 7 : | aspmx5.googlemail.com |
Alexa Ranking Information - Alexa.com
| Alexa rank : | 10,500,458 |
| Description : | Alnadeem-leather.com has a three-month global Alexa traffic rank of 10,500,458. The site is located in India. The site has been online for at least seven years. Alnadeem-leather.com is in the “Shopping” category. |
Compare this site to:
Search queries:
| leather manufacturers | 9.95% |
| men's belt manufacturers | 0.83% |
Quantcast Ranking Information - Quantcast.com
| Quantcast rank : | 0 | Average US daily traffic : | 0 |
Compete Ranking Information - Compete.com
| Compete rank : | 0 |
| Average daily unique visitors : | 0 |
MyWot Ranking Information - MyWot.com
| MyWot rank : | 0 |
| Trustworthiness : | 70 |
| Vendor reliability : | 0 |
| Privacy : | 0 |
| Child safety : | 0 |
| harringtonstore.com | celestiel.com | artistmayaweddingcards.com | aquaworldindia.com | alphamindpower.net |
| aktacarrier.com | airomaticsystems.com | acmcindia.com | srikrishnaswamykalyanamandapam.com | safety1st4u.com |
| alnaddy.com | alnadawi.com | alnadwah.com.sa | alnadeen.com | alnadeem.org |
| mr-s-leather.com | hideout-leather.co.uk | thighboots-and-leather.com | textiles-leather.cn | discount-leather.net |
Widgets
Stats summary widget
|
|
|
Ratings widget
|
|
|