| Aquaa World |
| Last Update : | 27/December/2011 |
| External links : | 1 |
| Archive : | Check how did the site look in the past? |
WWW.aquaworldindia .com - website information, analysis and reviews
General Info Keywords density Hosting Info Alexa Ranking Quantcast Ranking Compete Ranking Mywot Ranking Related Sites Widgets Reviews
General website information 
Keywords density
| Keyword | Occurrences | Percentage |
|---|---|---|
| water treatment | 3 | 4.58% |
| in the | 3 | 4.58% |
| field of | 2 | 3.05% |
| more than | 2 | 3.05% |
| and services | 2 | 3.05% |
| Keyword | Occurrences | Percentage |
|---|---|---|
| in the field | 2 | 4.58% |
| the field of | 2 | 4.58% |
| is a technology | 1 | 2.29% |
| plants it is | 1 | 2.29% |
| aquaaworld is a | 1 | 2.29% |
Server and Hosting Information
| Site IP address : | 182.18.138.38 |
| Server type : | Microsoft-IIS/6.0 |
| Powered by : | ASP.NET |
| MX Domain 1 : | mail2.aquaworldindia.com |
| MX Domain 2 : | mail.ritzhosting.com |
Alexa Ranking Information - Alexa.com
| Alexa rank : | 9,744,323 |
| Description : | Aquaworldindia.com is ranked #9,744,323 in the world according to the three-month Alexa traffic rankings. The site has been online for more than eight years. |
Compare this site to:
Search queries:
| aqua world in chennai | 68.79% |
| aquaa | 14.32% |
| aqua world(swimming pool) | 6.75% |
| aquarium in madipakkam | 6.58% |
| maxworth nagar | 2.56% |
| aqua world | 1.00% |
Quantcast Ranking Information - Quantcast.com
| Quantcast rank : | 0 | Average US daily traffic : | 0 |
Compete Ranking Information - Compete.com
| Compete rank : | 0 |
| Average daily unique visitors : | 0 |
MyWot Ranking Information - MyWot.com
| MyWot rank : | 0 |
| Trustworthiness : | 0 |
| Vendor reliability : | 0 |
| Privacy : | 0 |
| Child safety : | 0 |
| harringtonstore.com | celestiel.com | artistmayaweddingcards.com | alphamindpower.net | alnadeem-leather.com |
| aktacarrier.com | airomaticsystems.com | acmcindia.com | srikrishnaswamykalyanamandapam.com | safety1st4u.com |
| aquaworld-d1.com | aquaworldaquarium.com | aquaworld.com.mx | aquaworld-oarai.com | aquaworld-crete.com |
| musicworldindia.com | wildworldindia.com | worldindia.com | adventureworldindia.com | mansworldindia.com |
Widgets
Stats summary widget
|
|
|
Ratings widget
|
|
|